PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_339377g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 125aa    MW: 13549.4 Da    PI: 5.5968
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_339377g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer55.61.2e-1773108238
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegta 38 
                     ++v Y eC+kNhAas+Gg+avDGC Efm+s g+egta
  MA_339377g0010  73 KSVSYGECRKNHAASIGGYAVDGCAEFMAS-GDEGTA 108
                     5799*************************9.666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-1073107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-1575108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.6377125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MGLHRYRHVK DLAADELRSV FLHLRSEVPG TRSVQIQPQS IASAEEMGLS EIVQQIQAVS  60
AGTAREGDIA SRKSVSYGEC RKNHAASIGG YAVDGCAEFM ASGDEGTAXX XXXXXLAEMR  120
EQLQP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1082341e-149BT108234.1 Picea glauca clone GQ03118_L05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NSF79e-48A9NSF7_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-14mini zinc finger 2